Genscript Taq Polymerase

Development, Screening, And Analysis Of DNA Aptamer Libraries …
Taq DNA polymerase (Fisher Scientific Inc., Pittsburgh, PA) were added to each of the five PCR tubes which were brought to a final volume of 50 μl each with nuclease-free GenScript, Inc. (Piscataway, NJ): GDIQSRTPES KDVYANTQLVLQRPAVGTVHVPYSQAPSGF … Access Content

Conservation Of Synteny Between Guppy And Xiphophorus Genomes
Units of Taq DNA-polymerase, were carried GenScript Corporation (Piscataway, NJ). An Amplitron IIe thermal cycler (Barnstead, Dubuque, IO), a T3 thermocycler (Biometra, Göttingen, Germany) or a T-Gradient thermo-cycler (Biometra), was used for PCR. … Access Full Source

Design And Expression Of A Retro Doublet Of Cecropin With …
CECret gene and was later synthesized by GenScript. The resulting “retropeptide” is made up of L-amino acids in concentrations of the hybrid primer and 1 U of Taq DNA polymerase (Invitrogen, Brazil). The resulting doublet … Read Full Source

Histone Recognition And Nuclear Receptor Co-activator …
Generate rabbit polyclonal antiserum (GenScript, Piscataway, NJ, USA). Preparation of embryo extracts and western analysis were performed using PCR with HotStar Taq DNA polymerase (Qiagen, Valencia, CA, USA) using annealing temperatures appropriate for each primer pair. … Retrieve Document

Decrease In Antibody Somatic Hypermutation Frequency Under …
Taq polymerase (Eurogentec, Seraing, Belgium), 50 ng of liver TABLE 1. Primers used in this study Name Sequence, 5 to 3 Annealing www.genscript.com; Table 1). Each primer was designed across a junction between 2 exons to ensure that it could not … Fetch Document

Introductionof -LinkedGlycansintheLectinDomainof …
Bio-Rad, Taq DNA polymerase supplied by Fermentas (St. Leon-Roth, Germany), TOPO T/A cloning kit by Invitrogen, toxin Assay Kit was purchased from GenScript (Piscataway, NJ). Porcine bronchoalveolar lavage was obtained from adult … Fetch Full Source

The Response Of Dark Septate Endophytes (DSE) To Heavy Metals …
DNTP, 1 ml Taq polymerase, and 29 ml ddH 2 O. The conditions included an initial denaturation at 94uC for 3 min, followed by sequencing (Nanjing GenScript Corporation, China) using the universal primers SP6 and T7. All DNA sequences were edited … Read Here

Isolation And Characterization Of Nuclear-encoded …
19 PCR buffer, 0.5 U Taq DNA polymerase (Genscript), 0.5 lM of each forward and reverse primer (IDT), 200 lM of each dNTP(Genscript), and 2 mM MgCl 2 (New England Biolabs). Our PCR ampliļ¬cations in a MyCycler (Biorad) consisted of an initial denaturation at 95 C for 2 min, fol- … Retrieve Full Source

Isolation And Analysis Of Differentially Expressed Genes From …
PGM-T vector (Tiangen, Beijing, China), and sequenced by Genscript Inc., Nanjing, China. Sequence analysis and annotation of DEGs. Cloned synthesized was used as template for subsequent PCR using Taq Platinum Master Polymerase (Tiangen, Beijing, China). PCR products were cloned into a … Fetch Content

Comparison Of Heterologous Xylose Transporters In Recombinant …
Taq polymerase and various restriction enzymes were obtained from Fermentas. Transformation of E. coli and S. cerevisiae was performed using the calcium chloride (GenScript, Piscataway, NJ, USA), resulting in plasmids pSUT1 and pAt5g59250. … Get Doc